Basic Information | |
---|---|
Taxon OID | 3300033555 Open in IMG/M |
Scaffold ID | Ga0326733_1047573 Open in IMG/M |
Source Dataset Name | Glacier ice microbial communities from Ngari, Tibet, China - 14_GP2_30.8 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1133 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Ngari, Tibet | |||||||
Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038578 | Metagenome / Metatranscriptome | 165 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326733_10475732 | F038578 | AGGAG | VVLRGGSRDGESTRVQDGVRRVLAASDAPGLVDVYEANGETAELAGNDELALVMIHVGQEPAGDDPGLPRDHE |
⦗Top⦘ |