Scaffold Ga0326735_1085577

Overview

Basic Information

• Taxon OID: 3300033554
• Scaffold ID: Ga0326735_1085577
• Source Dataset Name: Glacier ice microbial communities from Ngari, Tibet, China - 37_GP2_109.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 892
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: China: Ngari, Tibet
• Coordinates
  • Lat. (^o): 35.2833
  • Long. (^o): 81.4833
  • Depth (m): 109

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038578	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326735_10855772	F038578	GGGGG	MSEELVVLRGGSRDGESTRVQDGVRRILAASDAPGLLDVYEANGETAELAGNDELALVMIHVGQEPAGDDPGLPRGLE