NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326734_1167025

Scaffold Ga0326734_1167025


Overview

Basic Information
Taxon OID3300033552 Open in IMG/M
Scaffold IDGa0326734_1167025 Open in IMG/M
Source Dataset NameGlacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)557
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameChina: Ngari, Tibet
CoordinatesLat. (o)35.2833Long. (o)81.4833Alt. (m)Depth (m)131
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038578Metagenome / Metatranscriptome165Y

Sequences

Protein IDFamilyRBSSequence
Ga0326734_11670252F038578GGGGGMSEELVVLRGGSRDGESTRVQDGVRRILAASDAPGLLDVYEANGETAELAGNDELALVMIHVGQEPAGDDPGLPRDHE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.