Basic Information | |
---|---|
Taxon OID | 3300033550 Open in IMG/M |
Scaffold ID | Ga0247829_10379579 Open in IMG/M |
Source Dataset Name | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1159 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.673 | Long. (o) | -77.032 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039208 | Metagenome / Metatranscriptome | 164 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247829_103795792 | F039208 | GGCGG | MARRDEMLSELAAGAAIPGVMGVGPGKTYDAVVAAHAPELTGDAVTFVALDDGTLVVNEDVPDGSLAAVADALEQMVSPPYRAAAGRTDGDTWTAVAESVGIVELRGFEGDEVDLSVVDGERTLTVDGEPTTGAVPALDALAEEHDSVALHAERVDGELFAVDVFPL |
⦗Top⦘ |