Basic Information | |
---|---|
Taxon OID | 3300033548 Open in IMG/M |
Scaffold ID | Ga0316216_1011855 Open in IMG/M |
Source Dataset Name | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 682 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Oslo | |||||||
Coordinates | Lat. (o) | 59.997 | Long. (o) | 10.7902 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003567 | Metagenome / Metatranscriptome | 479 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316216_10118552 | F003567 | GGAG | VVAGRLFLWSAACDEWVSCPPDEITWLDRSILSDNEDLTLHRAPRCAGLRYVHHRWELFSRD |
⦗Top⦘ |