Scaffold Ga0315915_1096908

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315915_1096908

Scaffold Ga0315915_1096908

Overview

Basic Information
Taxon OID	3300033464 Open in IMG/M
Scaffold ID	Ga0315915_1096908 Open in IMG/M
Source Dataset Name	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	528
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.06	Long. (^o)	-118.44	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028723	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315915_10969081	F028723	N/A	SELLSTLSQKCIKIHHAASMHYATLVHFVEGQDPLPIANTPFFPASEYFTREGRLFKQFKQTVLKQQEEAKAREYELLQKQLALEAALKLKDYLIAQLMNQQTQP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.