Scaffold Ga0326726_11541783

Overview

Basic Information

• Taxon OID: 3300033433
• Scaffold ID: Ga0326726_11541783
• Source Dataset Name: Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 647
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.3286
  • Long. (^o): -76.4792
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049830	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326726_115417831	F049830	N/A	VTRLHPDLANPENDVLAAKRARQAAPHVLTLTPFFPSAGDEVSGCFIADSNKQLEQFGVRSSVTAVSPIHYPRKKANPSAPADWVRYPQIPGNLGLSNAGRWLYARLLAEVPRLHREKPIDVIHAHAALPCGHAAAL