Scaffold Ga0326729_1018717

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326729_1018717

Scaffold Ga0326729_1018717

Overview

Basic Information
Taxon OID	3300033432 Open in IMG/M
Scaffold ID	Ga0326729_1018717 Open in IMG/M
Source Dataset Name	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1147
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	42.3286	Long. (^o)	-76.4792	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069387	Metagenome / Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0326729_10187172	F069387	GGA	VRTLVPIGLMAAAHLLVTLGLGVLTFLSQGPLDRPGPPGLVHRGLSATVDVLEFPGVWALRRLDRERLRGFEAAAVANSLLWGAGLVLAARGVRWLGGERPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.