Scaffold Ga0316193_11708420

Overview

Basic Information

• Taxon OID: 3300033429
• Scaffold ID: Ga0316193_11708420
• Source Dataset Name: Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.8826
  • Long. (^o): -69.6616
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076640	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316193_117084201	F076640	N/A	LPLAALVTILVVIVLYLARKEDVIRHKDVETLNELMQTGVVNKDNFFMFLQDLVSNKMIKEDSYETLGKLLQESFNETEETTQNLDDMK