NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316601_101876469

Scaffold Ga0316601_101876469


Overview

Basic Information
Taxon OID3300033419 Open in IMG/M
Scaffold IDGa0316601_101876469 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)604
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3777Long. (o)-82.5117Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047752Metagenome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0316601_1018764691F047752N/AALFLVLGFTICYTEVWGADWKEFAETTAGIFYYDKASVASPSKGFFRLWIHNVNKHETSLIEIDCREKDYRVLDVVEYDETDRMKDRFDYYDNPNWLVISQNTVPEPLHSILCPLREPETGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.