Basic Information | |
---|---|
Taxon OID | 3300033408 Open in IMG/M |
Scaffold ID | Ga0316605_10332159 Open in IMG/M |
Source Dataset Name | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1347 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Ohio | |||||||
Coordinates | Lat. (o) | 41.3777 | Long. (o) | -82.5117 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066277 | Metagenome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316605_103321592 | F066277 | N/A | MNRKKFVALFSTSILGAAVLKASPLNLFGSKKTSTSENPVKVKINPNAVNRDKSGKKNG |
⦗Top⦘ |