NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326728_10205252

Scaffold Ga0326728_10205252


Overview

Basic Information
Taxon OID3300033402 Open in IMG/M
Scaffold IDGa0326728_10205252 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1975
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002761Metagenome / Metatranscriptome531Y
F005112Metagenome / Metatranscriptome411Y
F010071Metagenome / Metatranscriptome308Y
F039911Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0326728_102052521F002761N/AKMVFTPSSTGSFTAGAVFWSMVWAGLGKLNELARFVGFKRAKPRESALRWINSHKVIALTTTEVVNYSVHGISSPLGVTFALGGTIVNTLMVAFVVPIWCRLTRLESRLS
Ga0326728_102052522F039911AGGAGMKYTIAGLLTVTAAIAGYFGIRRLMHKDLGFTPVKRYASKLASTLIHTETTAAQEAGVSPAA
Ga0326728_102052523F005112AGGAGMSLVAKYKLFWAGCIAALCGLAFWKNSKSYPRKSRLWKLGKSVIDTGLVLLMVLHAPALLLMYVVIWLTSPFKNKIMQSTAAFASILAVSHLAGIIFEAVAVFGVFAVDLLTGQVLARMDKRKRNILAKAA
Ga0326728_102052524F010071GAGGMTRLANLVLSVGEMLFHESKRLMFGFALGAAKELLGTPQTLGSGQLAFPRALQRKTVDGALLSGPRTDCEYAKFTLRKGLPTERRARALAVENEPHSVDDFNGVIEEGYGKGKKTLLYAGTGVVKVGNSGRLGRINVHAHKADKAGLHYDFVAEGVDPHTESFEVNIPNGDLKGRYAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.