Scaffold Ga0326728_10160898

Overview

Basic Information

• Taxon OID: 3300033402
• Scaffold ID: Ga0326728_10160898
• Source Dataset Name: Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2395
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 42.5488
  • Long. (^o): -76.2662
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050117	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326728_101608983	F050117	N/A	VAESEPIYGIADHTAFLNSAVATLLPEDFNTLQDARRKSLFDVSDESLEEYLAFTQLMIRLINKLDLYKAYRTH