Basic Information | |
---|---|
Taxon OID | 3300033402 Open in IMG/M |
Scaffold ID | Ga0326728_10001623 Open in IMG/M |
Source Dataset Name | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 78792 |
Total Scaffold Genes | 84 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 76 (90.48%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 42.5488 | Long. (o) | -76.2662 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085029 | Metagenome / Metatranscriptome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326728_1000162363 | F085029 | GGAGG | MKRLQIVAGIALIAFGLAFGTTAWPQKPSPGTGDRERERRSFAVNLVRAIQKAQLDFKSKHAIYANWDSLMGNGYFTSTGTKWASPDFPTVGQALYGSGPEIVPGWRLRLNVSHSGSSYDLLLEDVNDPICGYAALTDERGTIRQAKSVDCPNQ |
⦗Top⦘ |