NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326728_10000304

Scaffold Ga0326728_10000304


Overview

Basic Information
Taxon OID3300033402 Open in IMG/M
Scaffold IDGa0326728_10000304 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)200812
Total Scaffold Genes175 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)159 (90.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044858Metagenome / Metatranscriptome153Y
F061484Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0326728_10000304118F044858AGGAGGMEGFQSRRSCRVALSLPIRIIGIDDHGIDFTEEAHTLIVNLHGAMIQTTHQLKPEAEIRLLSHPTGQDGLFRVVSKLQSPDLQFTYWGVEKMDPERNIWGVNIPQLRPGYQIKVGVMLGCPKCSARESLFADETLLASLYEKGGVERTCEACKTAGLWKLLPFSWD
Ga0326728_10000304119F044858AGGAGGMEGFQSRRSCRVALSVPIRVIGIDYRGIDFTEEALTLVVNLHGAKIRMTHQMMPDSEFRLLSHPTGLDGLFRVVSKLQSSELKFTYWGVENMDPRKNIWGVDIPELRPGFQIKVRVMMECPTCSAHQPLFADETLLAALHEKGGAERTCEACKTPGLWKLLPFSGD
Ga0326728_10000304120F044858AGGAGGMEAIQSRRSCRVALSVPIFVVGFDSRGIDFTEEALTMVVNLHGAKIRLTHQLMPHSEILVLSHPTGRDSFFRVVSKLQSSDLEFTYWGVESMDPEKNIWGVNIPALEAGDESKVRVIVECPTCAKRESLRLGETPLAALQEKGGVERTCEACKTSAFWKLVPFQVV
Ga0326728_10000304121F061484N/AMGSEAGWGFTVDFAMTTGGLLVHSCDDWPCAVCRPGQISESRAYCLCLNCAYAIVAAASAGEQGARALLDEISDALSLLEAQQPEQRLLAN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.