Scaffold Ga0307510_10074301

Overview

Basic Information

• Taxon OID: 3300033180
• Scaffold ID: Ga0307510_10074301
• Source Dataset Name: Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3359
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.654
  • Long. (^o): -122.839

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016489	Metagenome	246	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307510_100743018	F016489	AGGGGG	LYATLDIWETTSKGPYLLGDSLGVMLLGSRRFVPSNQTLDLMGNGECRGRSLIQDSCALRCASWAAFLASSIAESRCSRDGMSVFLVGW