NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334885_1021066

Scaffold Ga0334885_1021066


Overview

Basic Information
Taxon OID3300033178 Open in IMG/M
Scaffold IDGa0334885_1021066 Open in IMG/M
Source Dataset NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_05-R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3397
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location NameNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082560Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0334885_10210662F082560AGAAGMYAVFRCAGIPVDGGIGVTEKSIVKKIQEWFKSKGGVCYKVHGGPMSAGFPDLIGCIEADAWVVEVKVPNAKPRVPKFVRAGYPEEMQKWMEQGATVLQAKTLYDWQRAGAVALVATSVEDMERRFEKEYFGYKIGGKYYGRIGNA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.