Scaffold Ga0272423_1019296

Overview

Basic Information

• Taxon OID: 3300033168
• Scaffold ID: Ga0272423_1019296
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5396
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -74.2
  • Long. (^o): 162.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051327	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272423_10192966	F051327	AGCAGG	MAKKKDRAFFVCPQWNEVADAGRSEGAGTAGPIRVNEKTLSAIKGGRPVARSTLRNALFAARSVSGAMFDVDAYIVDQRNRGPR