Scaffold Ga0334893_1055776

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334893_1055776

Scaffold Ga0334893_1055776

Overview

Basic Information
Taxon OID	3300033161 Open in IMG/M
Scaffold ID	Ga0334893_1055776 Open in IMG/M
Source Dataset Name	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_09_05-R3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	897
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location Name	Netherlands: Wageningen, Gelderland
Coordinates	Lat. (^o)	51.9691	Long. (^o)	5.6654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082560	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0334893_10557763	F082560	GGAGG	VTEKSIVKKIQEWFKSKGGVCHKVHGGPMSAGFPDLIGCIEADAWVVEVKVPNAKPRVPKSVRAGYPEEMQEWMEQGATVLQAKTLYDWQLAGAVALVATSVEDMERMFEKEYFGYKIGGKYYGRIGNA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.