Basic Information | |
---|---|
Taxon OID | 3300033161 Open in IMG/M |
Scaffold ID | Ga0334893_1003679 Open in IMG/M |
Source Dataset Name | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_09_05-R3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9428 |
Total Scaffold Genes | 24 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 23 (95.83%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands: Wageningen, Gelderland | |||||||
Coordinates | Lat. (o) | 51.9691 | Long. (o) | 5.6654 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061390 | Metagenome / Metatranscriptome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0334893_10036792 | F061390 | GAG | LEKETRREGSVGMVIISKEEAERLDRLVAQFGQRTVMEALEAKMMGNWSVIYFPDVDSWEVSDYGDRNFVIKDGGKCNCGKGFGKNGSCIHQVLVELKKWDLEDELGVE |
⦗Top⦘ |