Scaffold Ga0346503_1092973

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0346503_1092973

Scaffold Ga0346503_1092973

Overview

Basic Information
Taxon OID	3300033002 Open in IMG/M
Scaffold ID	Ga0346503_1092973 Open in IMG/M
Source Dataset Name	Soil microbial community from agricultural field in Dibrughar, Assam, India - D1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Eurofins Genomics India Pvt Ltd.
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	1859
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Crude Oil Contaminated Agricultural Soil Mecrobial Communities From Various Regions In India

Source Dataset Sampling Location
Location Name	Dibrughar, Assam, India
Coordinates	Lat. (^o)	26.2006043	Long. (^o)	92.9375739	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007999	Metagenome	341	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0346503_10929732	F007999	AGGA	MPTSEERAMLEERGAKARENLVAALRECCDLADAVETFEGKELLDVLMALDSIRFVMAESSQILQGVVRGFEG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.