NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335076_10422192

Scaffold Ga0335076_10422192


Overview

Basic Information
Taxon OID3300032955 Open in IMG/M
Scaffold IDGa0335076_10422192 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1217
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004084Metagenome / Metatranscriptome454Y
F022066Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
Ga0335076_104221922F004084GGAGGMPGTHTATAAAVTDGASRLARLRMSSLGVVTMLILEFILGMIYNLYGTAPTAKKSIGLFSSPVLALHVILAILLLIAAVMQLIRAIGVRHRLAVWLSAVGLVGILAAGFAGLGFTGNGAAGASLGMALAFAVSLACYVVLVFALAPSSTT
Ga0335076_104221923F022066N/AVRSVLTRPQAQAGKNHAPGTRLLLAGLGAFALALGLYVIYTAIHPKSFTMDPVDLAVYRSGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.