NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335075_10221963

Scaffold Ga0335075_10221963


Overview

Basic Information
Taxon OID3300032896 Open in IMG/M
Scaffold IDGa0335075_10221963 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2223
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F013663Metagenome / Metatranscriptome269Y
F014996Metagenome / Metatranscriptome258Y

Sequences

Protein IDFamilyRBSSequence
Ga0335075_102219632F013663N/AVYGRPDRNGEEQLGLLGAAWEGAARHWQDEVARHFETDHWAPLAQRSRAYLEALRTLLDVLETAERDTEFQ
Ga0335075_102219633F014996GGGGGVTRIHADIDALKGLLEALIRFRHAQLGVAERADDTIEMTRVSLADKASRWQARLEQDRAALEACRAAAGEAGADCSAYARAVEQSGERLEQVRRWQQRIDQDASEFHGTASGFRDLLEVGVPRAEGQLRSRIDSLEAARRLQAGSA
Ga0335075_102219634F001698N/AMSGVINDIDALAEFRAHLMQFNRDLAENFATMREHWRELGEVWRDDMYRLFGEALDEVTPGITTYLAATEGHEAHLAALIERLREYLETGIGAGAGTSRNETGRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.