Scaffold Ga0335080_10153584

Overview

Basic Information

• Taxon OID: 3300032828
• Scaffold ID: Ga0335080_10153584
• Source Dataset Name: Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2549
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location

• Location Name: USA: Florida
• Coordinates
  • Lat. (^o): 26.5065
  • Long. (^o): -80.2537

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016428	Metagenome / Metatranscriptome	247	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335080_101535845	F016428	N/A	LAAKKSPMQHEPGCGLAVVLPGGRRIEVHPDFDTNTFERLVSALERA