NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315741_11816120

Scaffold Ga0315741_11816120


Overview

Basic Information
Taxon OID3300032739 Open in IMG/M
Scaffold IDGa0315741_11816120 Open in IMG/M
Source Dataset NameForest Soil Metatranscriptomics Site 2 LB Combined Assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)538
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameSweden: Dalarna County
CoordinatesLat. (o)60.97Long. (o)15.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062300Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0315741_118161201F062300N/ARLSMYTFALIVVLIAICSAQKNYNPLPPEVAFISGGKFTGSLRTPVGALLTKGSIDYLAAAKPGDIEYEKREIVLEFGIETTKTWEVETTDRIDTWEITDLFPDCLHQTFDEESGTYPVCNAWTRNAVGAYIQNCTIYWGPADLADLSVAVVLSSNNQLVTYQDQIVLIGQFVESETVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.