Scaffold Ga0315741_10027481

Overview

Basic Information

• Taxon OID: 3300032739
• Scaffold ID: Ga0315741_10027481
• Source Dataset Name: Forest Soil Metatranscriptomics Site 2 LB Combined Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2206
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004586	Metagenome / Metatranscriptome	432	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315741_100274814	F004586	AGGAG	MTTDQNKCAHLPCRCLAQAGDKYCGQACKDAGSKEVEIACQCDHGPCPLTT