Basic Information | |
---|---|
Taxon OID | 3300032729 Open in IMG/M |
Scaffold ID | Ga0314697_10399208 Open in IMG/M |
Source Dataset Name | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 611 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Bergen | |||||||
Coordinates | Lat. (o) | 60.2696 | Long. (o) | 5.2187 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002856 | Metatranscriptome | 525 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314697_103992081 | F002856 | AGG | MAFRRNRSAIKAILAVIAAVCTFFSLTSTTFAHPYLHQKTEGTTTDYWADVGYFADGTSIVKAGNAINHGEPDVTDPHTNGSPLVASTYMADVGYFVDGTSMIRAGNALNHGEPDKPDPHTDGSPLPSSKYMADIGYFVDGTDVTKAGNALNHALAMGRGLTAKIGINFKASVPSRKKKK |
⦗Top⦘ |