Basic Information | |
---|---|
Taxon OID | 3300032562 Open in IMG/M |
Scaffold ID | Ga0316226_1015482 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4666 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium Tous-C9LFEB | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 46.0411 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034040 | Metagenome | 175 | Y |
F036529 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316226_10154821 | F036529 | N/A | MIPNFFLLTSYFSLLLAQELPSPDAERLSSWLIDAAALAAILLVFLKVIDHFKRRPSLKQELEKLLRQLRAELNQLRREQAEHIAQVRDRVEGAHQRVDLLTHDLNNKLQHLPGEIVDLLHKTGVLKG |
Ga0316226_10154823 | F034040 | N/A | MNPTAKSEAPYTDPEALLQARVLKILKPCLSYWLDEQTLYLTLNLGRPAVTRARLEAALRELRDKAYLDFRVDPLSRLTEWRLTPSGRVLAQPL |
⦗Top⦘ |