Scaffold Ga0316223_1002200

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316223_1002200

Scaffold Ga0316223_1002200

Overview

Basic Information
Taxon OID	3300032560 Open in IMG/M
Scaffold ID	Ga0316223_1002200 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16340
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (40.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	46.0411	Long. (^o)	-89.6861	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024484	Metagenome / Metatranscriptome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316223_100220011	F024484	N/A	MLTPTNHTVDTELFQEACNHLPKGAMKTSINQPTGDFFYDPWILKDEYKGTVWETLYNSLPVIKGEARIIILDPNQCYQRHADIDDRYHLNILGENCYLIDLVRDTMYPLEQDGIWYDMDASFLHTAANFGRKARVQLVVRKLLKKNQLVNPINIGLTTTMTNADHARHIFDNTVSPWLNEANKAGYIDNFSYSSVVVKFSIEQDKIDSLKHILPAEFIIV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.