Scaffold Ga0314689_10557345

Overview

Basic Information

• Taxon OID: 3300032518
• Scaffold ID: Ga0314689_10557345
• Source Dataset Name: Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 596
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway

Source Dataset Sampling Location

• Location Name: Norway: Bergen
• Coordinates
  • Lat. (^o): 60.2696
  • Long. (^o): 5.2187

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030324	Metagenome / Metatranscriptome	185	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0314689_105573451	F030324	N/A	YLCVTSMPKGIPAPGPFDLPGDNVNLANEGLAEGEHIFVRMGTIVRARRLDLRLLMDAHDLHNRGFVDKQTFQRALAYAFGNQWNELGMTTAEFEEVISPYETRRPQQLGEPISYVLWQKFANHVQKIADSLGTGKPGDY