Scaffold Ga0335397_10168453

Overview

Basic Information

• Taxon OID: 3300032420
• Scaffold ID: Ga0335397_10168453
• Source Dataset Name: Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2130
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Fryxell
• Coordinates
  • Lat. (^o): -77.605
  • Long. (^o): 163.163
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064415	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0335397_101684532	F064415	N/A	MSSLGDLAEPFEHQLLTLREAADVLRIGRSLAYQLAHEYLNSGGTSGLPVVRLGEKCLRIPSWALMELAATGRVVRLCDAEAPVGGASDAR