Scaffold Ga0325401_1238336

Overview

Basic Information

• Taxon OID: 3300032355
• Scaffold ID: Ga0325401_1238336
• Source Dataset Name: Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 535
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 32.1348
  • Long. (^o): -81.9657

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052698	Metagenome	142	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0325401_12383361	F052698	N/A	KFYPGKMRQFPRTFMIEVCSNYDVINDVFGRQEDKNCHQVKMWPPIHQLVNKSIVLNFGL