NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310345_10027223

Scaffold Ga0310345_10027223


Overview

Basic Information
Taxon OID3300032278 Open in IMG/M
Scaffold IDGa0310345_10027223 Open in IMG/M
Source Dataset NameMarine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4803
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Subtropical Gyre
CoordinatesLat. (o)22.7719Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007837Metagenome / Metatranscriptome344Y
F013596Metagenome / Metatranscriptome270Y
F016759Metagenome / Metatranscriptome245Y
F055296Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0310345_100272232F016759GAGMSMEPIQRLMSNPVAAALGTPQLLNDQVTQLSFIQMNIPNTLLDMYNSPDPAGGVGVDIYQDVLQKNSISTGRTFFTTAMSTASAGRAAIGPIRLASGQLQMESTMTAGVPAVLNNNIVLKFANGF
Ga0310345_100272233F007837N/AVQVKNTVNPLIINYPAQYQSLSQSLLIDNQDAANPVTVVLNNTSQNTITLPAGTFRAFNDAWIEQVNCTGASTNTQVTAQVAALRDIAPYGGGVTN
Ga0310345_100272236F013596GAGMEAFAPFLTVLSVVLPVSVCSVLIARIYRKNSALDPKITHKLRKQQEDYIGEVERKNRSLQNKLNSMQKGPELSEMGDLDGVLPELIGQLDGILPKWATKFIKGQPDLINTVIEYAKNNPDKAKELIGKFTKIKPKGGTTDQATMQGL
Ga0310345_100272237F055296N/AMVMESKLRSFQVENMAKYDKFREIQQSRNKKIGQRLNELIEKEVKEADPQFIELTAIRSKDAPDIITPNPFVMDQAHALIKWREYMLTLTKEQHGKLYNDVLAIKLATHEFDECVDCD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.