Basic Information | |
---|---|
Taxon OID | 3300032277 Open in IMG/M |
Scaffold ID | Ga0316202_10221277 Open in IMG/M |
Source Dataset Name | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 879 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maine | |||||||
Coordinates | Lat. (o) | 43.8603 | Long. (o) | -69.5781 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050000 | Metagenome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316202_102212773 | F050000 | N/A | MKNKKKLSRDRTNKGEKVFQMKGTFQEVWKEYMKLNEQLKNN |
⦗Top⦘ |