Scaffold Ga0316203_1187753

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316203_1187753

Scaffold Ga0316203_1187753

Overview

Basic Information
Taxon OID	3300032274 Open in IMG/M
Scaffold ID	Ga0316203_1187753 Open in IMG/M
Source Dataset Name	Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	570
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Maine
Coordinates	Lat. (^o)	43.8603	Long. (^o)	-69.5781	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023353	Metagenome / Metatranscriptome	210	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316203_11877531	F023353	N/A	EMKAEEVTEEVQASSEVLTREAVEGMIAEAIEATKKEFSSQIEERDAKITELSKQASPSIPRAPKMEAPVSVDLKSLSITERVAAIHNQFSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.