Scaffold Ga0316189_10585499

Overview

Basic Information

• Taxon OID: 3300032272
• Scaffold ID: Ga0316189_10585499
• Source Dataset Name: Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 855
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.9353
  • Long. (^o): -69.5766
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097365	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316189_105854992	F097365	AGGAG	MVSKSDWKEMKRHAFDAYARVGRMGVDEMENIVNIGIADGEFDEQEKAVLIDIISNLTRAEMNDAMWLKVDELIHKFDLHGDSEAFIEHLDDEDDF