Scaffold Ga0316198_10008888

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316198_10008888

Scaffold Ga0316198_10008888

Overview

Basic Information
Taxon OID	3300032251 Open in IMG/M
Scaffold ID	Ga0316198_10008888 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6246
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Netherlands
Coordinates	Lat. (^o)	51.4666	Long. (^o)	4.071	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087211	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316198_100088884	F087211	AGG	MIHVLKVTANALDADGVDAETRHSLIVFVKCEDEGGAYAPADAHLRQTGWQNVELVNCKAVPPEAIEKLDESLRNAYREAESHNVAAVLLKSS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.