Scaffold Ga0316187_10044998

Overview

Basic Information

• Taxon OID: 3300032231
• Scaffold ID: Ga0316187_10044998
• Source Dataset Name: Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3541
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.917
  • Long. (^o): -69.6219
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074896	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316187_100449982	F074896	N/A	MKKFLLIASIILLLGFVTTNLLSIAFNTDLKDAYAVENAFNSFSVSFLFEKNLPQESYYDGPQNNPSRFIEPFKLLLLGVGLIFLSLIGRQTFKR