Scaffold Ga0316593_10175637

Overview

Basic Information

• Taxon OID: 3300032168
• Scaffold ID: Ga0316593_10175637
• Source Dataset Name: Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 786
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location

• Location Name: USA: Alabama
• Coordinates
  • Lat. (^o): 30.2619
  • Long. (^o): -88.2383
  • Depth (m): .05 to .07

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089490	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316593_101756373	F089490	GAG	MTDGPERASHSSDKKLSMYRLMKSEKFTLDYLTSGLVSFYRQRQIKCFGRLRAALGACEVANNGGGSRYYLLNESRQEYYGGTWID