Scaffold Ga0315301_1003347

Overview

Basic Information

• Taxon OID: 3300032161
• Scaffold ID: Ga0315301_1003347
• Source Dataset Name: Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_Tmax_934 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2096
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 75.0007
  • Long. (^o): -150.0027
  • Depth (m): 497

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006550	Metagenome / Metatranscriptome	370	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315301_10033471	F006550	GAGG	MQAKINKREIDYKGQQLWLNPVDKTVYATDGAPTYSFSEVNGTPIYNYNTHFDAVKTAKDRLGTSYVHDAFVDQEFKSLAEDYVSDVKLGGRQRQAALRSSVNSAVDIVNVWETVLGKRDRVYAGKNLAKEIAVPNLLISIDTVTKFTGMEKLDEGMRARVKELPYTRSTFTAAKYGLKFIIHEEARLKNVHNVLQDSIQVASTKIEQRQSFDVLAITETNTAQAAGGLWDTFTSNTDHSINDPTIDIGIASLNIEGSGVGGKLNRVGMHQLTFAKYTGNTFLRGVASNGPRDYNYEPGTSDLVGIPGIGLVLDNGIKQGDVHCVDTELEPNCALFQGPQRVGSQHDEETGDDKYFIIDYHLAAKIQSETGRLITGAI