Scaffold Ga0311301_11225069

Overview

Basic Information

• Taxon OID: 3300032160
• Scaffold ID: Ga0311301_11225069
• Source Dataset Name: Sb_50d combined assembly (MetaSPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 959
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location

• Location Name: Germany: Weissenstadt
• Coordinates
  • Lat. (^o): 50.1318
  • Long. (^o): 11.881

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008041	Metagenome / Metatranscriptome	340	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0311301_112250691	F008041	N/A	PKRRPRVVYMQDRLFQVEEFGAATQNTAAIIFICPYGTPIEKVRFAIRRFLKDGYHVLAYQTTAAVFTEADPMILPELISQVREDIRSRIAKLTSEGVTEFGFFGSSLGSFILYNCVGREIPELRWGVFNTGGNIARGLWNMPMLRQVHVARGWSLPRLEEAWAELQWPDFGRLDGCRFVFASSRRDDIAPMSDISEYLEPMLRAGADVSVREVPAIGHRTTVIAGLWKGPQLVRMVRAAQPI