NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311301_10283144

Scaffold Ga0311301_10283144


Overview

Basic Information
Taxon OID3300032160 Open in IMG/M
Scaffold IDGa0311301_10283144 Open in IMG/M
Source Dataset NameSb_50d combined assembly (MetaSPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2680
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013663Metagenome / Metatranscriptome269Y
F014996Metagenome / Metatranscriptome258Y
F037832Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0311301_102831442F013663GGAVPTRPDRDGDEQLRLLGAAWEEAARHWQDEVARQFEADHWTPLVEQSRGYLEALRSLLDMFEAAERDTEF
Ga0311301_102831443F014996GGAVTTVHADIDALKGLHEAMVRFRYAQREVTERGGDEIELTRASLAAKASHWQARLEQDRAELEACRASGGEEAAPDCSAYARAVEQTGERLELIRRWQQRVEVEADEFRGTAGAFGDLLDSGLPRAETQLLALITSLEAARRVQASGS
Ga0311301_102831445F037832N/ALRQAVRPAIFAHFLLAEDQERARQLAAECEDLLFLTRELLKAAGLADILGARAPSSPCGAGPGSAPPEEEDGGDRQAQLLGAYAEAGMLWAKVVGSTTALAQALLGRGDRDGARRLAGFLADAGEDGPAAELNIQLGKAVWDSCRGPLQDISNTMPPAAIGTAIDALRAVLLEVPEDFPDRNREVNRFLPPLAASVLAVMREQEIDIPYSSRVEHIAAGGVARYPDIVKLSLDEIAAEFDGLCYRPANQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.