Scaffold Ga0314779_1033553

Overview

Basic Information

• Taxon OID: 3300032150
• Scaffold ID: Ga0314779_1033553
• Source Dataset Name: Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 517
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 71.473
  • Long. (^o): -156.7294
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096063	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314779_10335531	F096063	N/A	TMQGDLYSGIYSKDEVQRILEINARPTILVKPDEAFYKKSAMEHGPSWAEKREFVHWLIHESNISASSKRYLRENDYWVEKYALRGLKYGLFATAATFTFFPVIRRQPFVKRMALSLVPMAYFMNWGYVWGHENWWRRAKEVVVTYEIYTGVRSKMTMK