Scaffold Ga0314779_1012472

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314779_1012472

Scaffold Ga0314779_1012472

Overview

Basic Information
Taxon OID	3300032150 Open in IMG/M
Scaffold ID	Ga0314779_1012472 Open in IMG/M
Source Dataset Name	Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	794
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	71.473	Long. (^o)	-156.7294	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090465	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314779_10124723	F090465	N/A	ATSSKITNAQVLECIKEMREGTKARKFQQTVELQISLKDYDP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.