Scaffold Ga0315910_10122409

Overview

Basic Information

• Taxon OID: 3300032144
• Scaffold ID: Ga0315910_10122409
• Source Dataset Name: Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1921
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.0136
  • Long. (^o): -118.4673
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045841	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315910_101224093	F045841	AGG	MIVRIHDIVAVCPRCGADDFEQTSAGALRLPSELRCTGCGAKTRYLALLDQIGEEAIRRANEAIDNLKKHPSRPRRPKE