NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316201_11038211

Scaffold Ga0316201_11038211


Overview

Basic Information
Taxon OID3300032136 Open in IMG/M
Scaffold IDGa0316201_11038211 Open in IMG/M
Source Dataset NameCoastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)688
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7869Long. (o)-75.1074Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033408Metagenome177N
F065237Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0316201_110382111F065237N/AEFLNTLAFHTTISKQRQKRLEKAAASGFESYVCACLNELL
Ga0316201_110382112F033408N/AMALSASHQVSGTHQPAYNDNLWVVQETSTGITGNFNFKFICDVKNTSDDLLTRIKVPLHFGSNNRGVFNIARVLESYVTHDWDFTDTASQSCTNSFFDYKLEFGYEYSTGATSPIEQTLAELTVTGNTVWNAALSPREFLNYDEGDYLMEASSTATFLTNNNAKKIYRDQKDWLYA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.