Basic Information | |
---|---|
Taxon OID | 3300032136 Open in IMG/M |
Scaffold ID | Ga0316201_10580294 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 959 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Delaware | |||||||
Coordinates | Lat. (o) | 38.7869 | Long. (o) | -75.1074 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029926 | Metagenome / Metatranscriptome | 187 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316201_105802942 | F029926 | N/A | MGKSMRLDQIVKPNAKLMTKLAQDAIDKIILDADKGNFQNGKGNYRYSDNGAGVGFRTFRKGSKKWVANIDSYKNRKASGMRYPNGQRVKGYENQSTDTTTSFVNMRLTGKTFNTMRASGKNDTAIITYDRGEIVLGNQKRGYDIYDLSDKNKEFIADRFGKELLDKNIKKYVSKTTIIK |
⦗Top⦘ |