Scaffold Ga0307415_100011125

Overview

Basic Information

• Taxon OID: 3300032126
• Scaffold ID: Ga0307415_100011125
• Source Dataset Name: Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5131
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5
  • Long. (^o): -121.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057956	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307415_1000111254	F057956	N/A	MWKNLARTDDTWGHVVDTEEQRRRAFVELEMAAVWHGHERGVVTRDEVHRRLEELERLLWRRVLGQLRKVTPGASVYVGFAVGKEPAQELA