Scaffold Ga0316053_104280

Overview

Basic Information

• Taxon OID: 3300032120
• Scaffold ID: Ga0316053_104280
• Source Dataset Name: Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 876
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0448
  • Long. (^o): 13.618

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044536	Metagenome / Metatranscriptome	154	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316053_1042802	F044536	GGAGG	MSFHPRIRSVRVRCACFLLLLTVVLLSAVTLAQDVETPKYEIFVGYQWLHPGGFVPVPFGNYNAPNGMTLSDMPAGFGASFTYNFQKYFGLEGDFGNNWDNYETTISAGPKATYRTENANFFVNTLLSYNRLAVNGLPTGNGIGAILGGGMDLKITHLFYLRLFEADYVWGRQNYSQVVSSAFPDLRRVSLGGVRLRTGLVFNFGYPPAVTP