Scaffold Ga0315903_10188941

Overview

Basic Information

• Taxon OID: 3300032116
• Scaffold ID: Ga0315903_10188941
• Source Dataset Name: Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1844
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Lake Erie, Ohio
• Coordinates
  • Lat. (^o): 41.7464
  • Long. (^o): -83.3444
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017813	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315903_101889411	F017813	AGGAG	MPTKLVVDCSTGEVSEVELTAEEIAQREADAQAFAEAEAAR